Kitasatospora albolonga: B7C62_26745 Help Entry B7C62_26745       CDS       T05009                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism kab  Kitasatospora albolonga Pathway kab00261   Monobactam biosynthesis kab01100   Metabolic pathways kab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B7C62_26745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kab01008]     B7C62_26745 Polyketide biosynthesis proteins [BR:kab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B7C62_26745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARF75451 LinkDB All DBs Position complement(6018991..6019197) Genome browser AA seq 68 aa AA seqDB search MGNPFDDPEGTFLVLRNDNDQNSLWPGFAEVPAGWEIAFGPNGRTACIDYIETHWIDIRP RTRIASNS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggggaatccgttcgacgacccggaaggcacttttctggtgctgcggaacgataacgat cagaatagcctctggcccgggttcgcagaggttccggcgggctgggaaatcgctttcggc ccgaacgggagaaccgcctgcatcgattacatagaaactcattggatcgatatccggcct cgcacccgaattgcctcgaattcatag

DBGET integrated database retrieval system