Kitasatospora albolonga: B7C62_34500 Help Entry B7C62_34500       CDS       T05009                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism kab  Kitasatospora albolonga Pathway kab00261   Monobactam biosynthesis kab01100   Metabolic pathways kab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B7C62_34500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kab01008]     B7C62_34500 Polyketide biosynthesis proteins [BR:kab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B7C62_34500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  ARF76831 LinkDB All DBs Position 7940573..7940791 Genome browser AA seq 72 aa AA seqDB search MTNPFEDENGTYLVLVNDEGQHSLWPAFAEVPGGWTVARTEGSRQDCLDYVERNWTDLRP KSLLESAAADPA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgaccaaccccttcgaggacgagaacggcacctacctggtgcttgtcaacgacgagggc cagcactccctgtggcccgccttcgccgaggtgccgggcggctggaccgtggcccgcacg gagggcagccgtcaggactgcctggactacgtggagcggaactggacggacctgcggccc aagagcctgctggagagcgcggcggccgatccggcgtga

DBGET integrated database retrieval system