Kaistia sp. 32K: K32_27100 Help Entry K32_27100         CDS       T06998                                  Symbol folB Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism kai  Kaistia sp. 32K Pathway kai00790   Folate biosynthesis kai01100   Metabolic pathways kai01240   Biosynthesis of cofactors Module kai_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:kai00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     K32_27100 (folB) Enzymes [BR:kai01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      K32_27100 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      K32_27100 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      K32_27100 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB MgtE_N Motif Other DBs NCBI-ProteinID:  BCP54093 UniProt:  A0A7R7T6Y2 LinkDB All DBs Position 2922081..2922452 Genome browser AA seq 123 aa AA seqDB search MTDRIFINDLRFYGYHGVFPEEAVLGQRFRVDLTCELDLAEGARNDDLTKTVHYGELAQL VEKIGKTRRFKLIEALAEAMATEIFATYPPIEKLTIRITKPEAPVPLSTGVIAVEIERER TRD NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccgcatcttcatcaacgacctccgcttctacggctaccacggcgtgtttccg gaggaggccgtgctcggccagcgattccgcgtcgacttgacctgcgagctcgacctcgcg gagggcgcccgcaacgacgacctgacgaagaccgtccactatggcgagctggcccagctc gttgaaaagatcggcaagacgcgccgcttcaagctgatcgaggcgctcgccgaagccatg gcgaccgagatcttcgcgacctatccgccgatcgagaaactgacgatccgcatcaccaag ccggaggcccccgtgcctctctcgaccggcgtcatcgccgtcgagatcgagcgggagcgg acgcgtgactga

DBGET integrated database retrieval system