Kutzneria albida: KALB_2592 Help Entry KALB_2592         CDS       T03039                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism kal  Kutzneria albida Pathway kal00261   Monobactam biosynthesis kal01100   Metabolic pathways kal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KALB_2592  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kal01008]     KALB_2592 Polyketide biosynthesis proteins [BR:kal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KALB_2592 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHH95960 UniProt:  W5W5A9 LinkDB All DBs Position 2861877..2862086 Genome browser AA seq 69 aa AA seqDB search MTNPFDSEDGSFFVLVNDEGQHSLWPAFAEVPAGWTTVFGEADKQACVDYVETNWTDMRP KSLIEAMDK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccctttgacagcgaggacggctccttcttcgtgctggtcaacgacgagggg cagcactcgctgtggcccgccttcgccgaggtccccgccgggtggacgaccgtcttcggc gaggcggacaagcaggcctgcgtcgactacgtggagacgaactggacggacatgcggccg aagagcttgatcgaagcgatggacaagtag

DBGET integrated database retrieval system