Kosakonia cowanii: BWI95_06450 Help Entry BWI95_06450       CDS       T04691                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism kco  Kosakonia cowanii Pathway kco00261   Monobactam biosynthesis kco01100   Metabolic pathways kco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kco00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BWI95_06450  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kco01008]     BWI95_06450 Polyketide biosynthesis proteins [BR:kco01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BWI95_06450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APZ04718 UniProt:  A0A807LFL2 LinkDB All DBs Position 1375047..1375247 Genome browser AA seq 66 aa AA seqDB search MSNPFENENIPFLVLVNAENQHSLWPEFMVVPEGWDVVCGPASRKACIEYIEENWKDIKP KTLQNL NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccattcgaaaatgaaaacattccttttttagtattagtaaacgcagagaat cagcactctttatggccggaatttatggttgtccccgagggttgggacgtggtctgcggg cccgccagtcgcaaggcgtgcattgagtacatcgaggaaaactggaaggatatcaagccg aaaactttacaaaatctataa

DBGET integrated database retrieval system