Candidatus Korarchaeum cryptofilum: Kcr_0580 Help Entry Kcr_0580          CDS       T00668                                  Name (GenBank) Lipoate-protein ligase A   KO K03800   lipoate---protein ligase [EC:6.3.1.20] Organism kcr  Candidatus Korarchaeum cryptofilum Pathway kcr00785   Lipoic acid metabolism kcr01100   Metabolic pathways kcr01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:kcr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     Kcr_0580 Enzymes [BR:kcr01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)     6.3.1.20  lipoate---protein ligase      Kcr_0580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lip_prot_lig_C HBS1_N Motif Other DBs NCBI-ProteinID:  ACB07333 UniProt:  B1L4F4 LinkDB All DBs Position complement(589803..590063) Genome browser AA seq 86 aa AA seqDB search MKVIRSKAGKTLEIRLELDGNLIKEVEISGDFMVFPSDAIEELERKLKGRALGEHEGVVR EVLRKAELVGITEDDIIDAIWDVAGS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaagtgatcagatccaaggctggaaaaacgcttgagataaggctggagctagatggg aatttgataaaggaggtggagatctcgggagatttcatggttttcccgagcgatgcaatc gaggaacttgagaggaagctgaaaggtagggccttaggggagcacgaaggagtagttagg gaagtcctgaggaaggccgagctagtcgggataaccgaggatgatataatagacgctata tgggatgtcgcgggatcttag

DBGET integrated database retrieval system