Candidatus Korarchaeum cryptofilum: Kcr_1264 Help Entry Kcr_1264          CDS       T00668                                  Name (GenBank) Ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism kcr  Candidatus Korarchaeum cryptofilum Pathway kcr00020   Citrate cycle (TCA cycle) kcr00720   Carbon fixation pathways in prokaryotes kcr01100   Metabolic pathways kcr01110   Biosynthesis of secondary metabolites kcr01120   Microbial metabolism in diverse environments kcr01200   Carbon metabolism kcr01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:kcr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Kcr_1264   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     Kcr_1264 Enzymes [BR:kcr01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Kcr_1264 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_16 Fer4_6 Fer4_21 Fer4 Fer4_2 Fer4_9 Fer4_10 Fer4_8 Fer4_4 Fer4_17 Fer4_3 Motif Other DBs NCBI-ProteinID:  ACB08010 UniProt:  B1L6D1 LinkDB All DBs Position 1265281..1265610 Genome browser AA seq 109 aa AA seqDB search MSTAKVRQIVVSDKLCKACYLCIWACPWGVLEIKEERNWRGIKKPYAAKIEQCRACRLCE LYCPDFAIQVVVDEEEEKKILEVEERYERKWFDRLKKRDEIISKGVWWL NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgtcgacagctaaggtaaggcaaatagtcgtcagtgataagctctgtaaggcatgttac ctctgcatatgggcctgcccatggggggtgctggagataaaggaggagaggaactggagg gggataaagaagccgtatgcagccaagattgagcaatgtagagcttgcaggttatgtgaa ctctattgtccggatttcgcgatacaagtggtagtcgatgaggaagaggagaagaagatc ctggaggttgaggagagatacgagaggaagtggtttgataggttaaagaagagggatgag ataatctcgaagggtgtgtggtggttatga

DBGET integrated database retrieval system