Kribbella flavida: Kfla_4109 Help Entry Kfla_4109         CDS       T01155                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism kfl  Kribbella flavida Pathway kfl00261   Monobactam biosynthesis kfl01100   Metabolic pathways kfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kfl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Kfla_4109  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kfl01008]     Kfla_4109 Polyketide biosynthesis proteins [BR:kfl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Kfla_4109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADB33156 UniProt:  D2PSL8 LinkDB All DBs Position complement(4402538..4402744) Genome browser AA seq 68 aa AA seqDB search MTSNSRRTVVRNDEQQYSIWPLGRDLPPGWAEVGISGSEEDCLEYIERTWTDLRPLSLRR TLTAADEQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaacagccggcgcaccgtcgttcgcaacgacgagcagcagtactcgatctgg ccgctcggccgggacctgccgccgggctgggccgaggtcgggatcagcgggtcggaggag gactgcctggagtacatcgagcggacctggacggacctgcgcccgttgagtcttcggcgc acactgacggcggccgacgagcaatga

DBGET integrated database retrieval system