Kitasatospora sp. NA04385: HUT16_20130 Help Entry HUT16_20130       CDS       T08635                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism kis  Kitasatospora sp. NA04385 Pathway kis00790   Folate biosynthesis kis01100   Metabolic pathways kis01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:kis00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HUT16_20130 (folB) Enzymes [BR:kis01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HUT16_20130 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HUT16_20130 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HUT16_20130 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Rv2993c-like_N Peptidase_S74 Motif Other DBs NCBI-ProteinID:  QKW24382 UniProt:  A0A7H8L770 LinkDB All DBs Position 4491124..4491483 Genome browser AA seq 119 aa AA seqDB search MDRVTLRGLRARGHHGVFERERIEGQTFVVDLVLFLDTRPAAAGDDLTRTAHYGVIAEEV TAVIAGDPVDLIETLAQRIADQCLRHEVVEEVEVTVHKPDAPITVPFDDVTITIRRGRA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt ctggaccgcgtcaccctgcgcgggctgcgtgcccgcggccaccacggcgtcttcgagcgc gagcggatcgaggggcagaccttcgtggtcgacctggtgctgttcctcgacaccaggccg gccgccgcgggtgacgacctgacccgcaccgcgcactacggcgtgatcgcggaggaggtc accgcggtgatcgccggcgacccggtcgacctgatcgagacgctggcccagcggatcgcc gaccagtgcctgcgccacgaggtggtcgaggaggtcgaggtcaccgtgcacaagccggac gccccgatcaccgtcccgttcgacgacgtcaccatcacgatccgccggggccgcgcctga

DBGET integrated database retrieval system