Kitasatospora sp. MMS16-BH015: CFP65_5728 Help Entry CFP65_5728        CDS       T05366                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism kit  Kitasatospora sp. MMS16-BH015 Pathway kit00261   Monobactam biosynthesis kit01100   Metabolic pathways kit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kit00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CFP65_5728  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kit01008]     CFP65_5728 Polyketide biosynthesis proteins [BR:kit01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CFP65_5728 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AUG80420 UniProt:  A0A2H5B7T5 LinkDB All DBs Position complement(6728145..6728351) Genome browser AA seq 68 aa AA seqDB search MTEDESGTRYRVVVNHEEQYSIWFADRAAPEGWRDAGPSGSQEECLRWVDEHWTDMRPLS LRGGPEHP NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactgaggacgagagcggcacccggtaccgagtcgtcgtcaaccacgaggagcagtac tcgatctggttcgccgatcgggccgccccggagggctggcgggacgcggggccgtccggc tcccaggaggagtgcctgcggtgggtcgacgaacactggacggacatgcggccgctctcc ctgcgcggcggcccggagcacccctga

DBGET integrated database retrieval system