Kosakonia sp. CCTCC M2018092: EH164_03305 Help Entry EH164_03305       CDS       T05734                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism kot  Kosakonia sp. CCTCC M2018092 Pathway kot00261   Monobactam biosynthesis kot01100   Metabolic pathways kot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kot00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EH164_03305  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kot01008]     EH164_03305 Polyketide biosynthesis proteins [BR:kot01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EH164_03305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZI86156 LinkDB All DBs Position complement(699436..699636) Genome browser AA seq 66 aa AA seqDB search MSNPFENENLIFIVLVNQENQHSLWPEFIPVPDGWEPVFGPASRAECLHYIEENWHDIKP KSLQNM NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgaaaatgagaaccttatattcatcgtgttagtgaatcaggaaaac caacactcattatggcccgagtttattccggtgccggatggctgggagccagtatttggg ccagcaagccgggctgagtgcctgcactatattgaggagaactggcacgacattaagcca aaaagcctgcaaaacatgtag

DBGET integrated database retrieval system