Keratinibaculum paraultunense: JL105_04940 Help Entry JL105_04940       CDS       T07032                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism kpar  Keratinibaculum paraultunense Pathway kpar00020   Citrate cycle (TCA cycle) kpar01100   Metabolic pathways kpar01110   Biosynthesis of secondary metabolites kpar01120   Microbial metabolism in diverse environments kpar01200   Carbon metabolism kpar01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:kpar00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JL105_04940 Enzymes [BR:kpar01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JL105_04940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_10 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_4 Fer4_16 Fer4_8 Fer4_17 Fer4_15 Fer4_22 Fer4_3 Fer4_13 Metallothi_Euk2 Fer4_18 Motif Other DBs NCBI-ProteinID:  QQY80842 LinkDB All DBs Position 1002793..1002981 Genome browser AA seq 62 aa AA seqDB search MLKKLNLEKELCKGCGICVAFCPKNVLVLKQGKAEIKNLDDCIQCGQCELRCPDYAIYLG GI NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgttaaaaaagcttaatttagaaaaagaattgtgtaaaggttgtggaatatgtgttgcc ttctgtccgaagaatgttttagttttgaaacaaggtaaagcagaaataaaaaatctagac gattgtatacaatgtggtcaatgtgaattaaggtgtccagattacgctatttatttagga gggatataa

DBGET integrated database retrieval system