Klebsiella variicola 342: KPK_0658 Help Entry KPK_0658          CDS       T00772                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism kpe  Klebsiella variicola 342 Pathway kpe00790   Folate biosynthesis kpe01100   Metabolic pathways kpe01240   Biosynthesis of cofactors Module kpe_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:kpe00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     KPK_0658 (folB) Enzymes [BR:kpe01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      KPK_0658 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      KPK_0658 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      KPK_0658 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ACI06643 UniProt:  B5XU33 LinkDB All DBs Position 669799..670182 Genome browser AA seq 127 aa AA seqDB search MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEIAWDNRKAAASDDVSDCLSYADISERV IAHVEGGKFALVERVAEEVADLLLETFQSPWVRIKVSKPGAVARAANVGVIIERGLNLKQ NFSGHTC NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggatattgtatttatagagcaactttcggtaatcaccaccattggtgtttatgactgg gaacaaaccattgagcagaagctggtgttcgatatcgaaattgcatgggataaccgcaag gcggccgccagcgatgatgtcagcgactgcctcagctatgctgatatcagcgagcgagtg atcgcgcatgtggaggggggaaaattcgcgttagtggagcgggtggcggaagaagtggcc gacctgctgctggaaacattccagtcgccatgggtgcgtattaaagtcagcaaacctggc gccgtggcccgcgcggcaaatgtcggtgtgattattgaacgtggccttaatctgaaacaa aacttttcaggtcatacttgttaa

DBGET integrated database retrieval system