Kibdelosporangium phytohabitans: AOZ06_19095 Help Entry AOZ06_19095       CDS       T04088                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism kphy  Kibdelosporangium phytohabitans Pathway kphy00261   Monobactam biosynthesis kphy01100   Metabolic pathways kphy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kphy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AOZ06_19095  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kphy01008]     AOZ06_19095 Polyketide biosynthesis proteins [BR:kphy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AOZ06_19095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALG08742 UniProt:  A0A0N9HZD7 LinkDB All DBs Position 4165105..4165329 Genome browser AA seq 74 aa AA seqDB search MSTNPFDDPDGTFHVLVNDEGQHSLWPSFADVPSGWTVVVRETDRQSALAYVEENWTDMR PASLVRAMDGSTGG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaacccgttcgacgacccggatggcacattccacgtactggtgaacgacgag ggccagcactcgctgtggccgtcgttcgccgacgtgccgtccggctggaccgtggtggta cgggaaaccgaccgccagtcggctctcgcctacgtcgaggagaactggacggacatgcgg ccagcgagcctggtccgcgcgatggacggctcgaccggcggctga

DBGET integrated database retrieval system