Kribbella qitaiheensis: F1D05_02820 Help Entry F1D05_02820       CDS       T06749                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism kqi  Kribbella qitaiheensis Pathway kqi00261   Monobactam biosynthesis kqi01100   Metabolic pathways kqi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kqi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F1D05_02820  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kqi01008]     F1D05_02820 Polyketide biosynthesis proteins [BR:kqi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F1D05_02820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNE17034 UniProt:  A0A7G6WSR9 LinkDB All DBs Position 669915..670136 Genome browser AA seq 73 aa AA seqDB search MSVNPFDDENGEFHVLVNDENQHSLWPVFAEIPAGWRAVFGPGGRAESLAYIEENWTDMR PRSLREAMAADAG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaaccccttcgacgacgagaacggcgagttccacgtcctggtcaacgacgag aaccagcactcgctgtggccggtgttcgcggagatcccggccggctggcgggcggtcttc ggcccggggggacgggccgagagcctggcctatatcgaggagaactggaccgacatgcga ccccggagcctgcgcgaggcgatggccgccgacgcgggctga

DBGET integrated database retrieval system