Kribbella qitaiheensis: F1D05_30890 Help Entry F1D05_30890       CDS       T06749                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism kqi  Kribbella qitaiheensis Pathway kqi00261   Monobactam biosynthesis kqi01100   Metabolic pathways kqi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kqi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F1D05_30890  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kqi01008]     F1D05_30890 Polyketide biosynthesis proteins [BR:kqi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F1D05_30890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNE21524 UniProt:  A0A7G6X5K9 LinkDB All DBs Position 6491634..6491852 Genome browser AA seq 72 aa AA seqDB search MPEATDDRSYLVVRNDEEQYSLLLADRPLPKGWRPAGFEGDREACLAHIGATWTDLRPLS LRRRLASASTTA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgcctgaagcaactgacgaccgctcctatctggtggtccgcaacgacgaggagcagtac tcgctactgctcgctgaccggccgcttccgaagggctggcggccggctgggttcgaaggc gaccgtgaggcctgcctggcgcacatcggtgcgacctggaccgacctgcgcccgctgagc ctgcgccgccgcctggcgagcgcgtccaccactgcctga

DBGET integrated database retrieval system