Kocuria rhizophila: KRH_21450 Help Entry KRH_21450         CDS       T00701                                  Symbol soxD Name (GenBank) sarcosine oxidase delta subunit   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism krh  Kocuria rhizophila Pathway krh00260   Glycine, serine and threonine metabolism krh01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:krh00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     KRH_21450 (soxD) Enzymes [BR:krh01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      KRH_21450 (soxD)     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      KRH_21450 (soxD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  BAG30492 NITE:  KRH_21450 UniProt:  B2GHY0 LinkDB All DBs Position 2467950..2468243 Genome browser AA seq 97 aa AA seqDB search MLLIECPYCGPRDETEYHYGGEAHVPYPEDPSELSDREWAEYLFYRNNPKGLLKERWAHT VGCRRWFNVVRDTATYEITAVYRMGENAPEQEPGGTR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgttgctgatcgaatgcccctactgcgggccgcgcgacgagaccgagtaccactacggc ggtgaggcccacgtgccctacccggaggacccctccgagctctcggaccgggagtgggcc gagtacctcttctaccgcaacaaccccaagggcctgctcaaggagcgctgggcccacacg gtggggtgccgccgctggttcaacgtggtccgggacaccgccacgtacgagatcacggcc gtctaccgcatgggcgagaacgcccccgagcaggagccaggaggcacgcgatga

DBGET integrated database retrieval system