Kutzneria sp. CA-103260: JJ691_47660 Help Entry JJ691_47660       CDS       T08943                                  Symbol mbtH_3 Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism kut  Kutzneria sp. CA-103260 Pathway kut00261   Monobactam biosynthesis kut01100   Metabolic pathways kut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kut00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JJ691_47660 (mbtH_3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kut01008]     JJ691_47660 (mbtH_3) Polyketide biosynthesis proteins [BR:kut01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JJ691_47660 (mbtH_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QUQ67038 LinkDB All DBs Position complement(5485594..5485779) Genome browser AA seq 61 aa AA seqDB search MGLTYAVVRNDEEQYSIWLADRELPLGWHGVGFTGSEQECLDHVAEVWQDMRPASLRRAM G NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgggactcacctacgccgtagtgcgcaacgacgaggagcagtactcgatctggctcgcc gaccgcgagctgccgctgggctggcacggcgtcgggttcaccgggtcggagcaggagtgc ctcgaccacgtggccgaggtgtggcaggacatgcgtccggccagcctgcgccgcgcgatg ggctga

DBGET integrated database retrieval system