Kutzneria sp. CA-103260: JJ691_70520 Help Entry JJ691_70520       CDS       T08943                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism kut  Kutzneria sp. CA-103260 Pathway kut00261   Monobactam biosynthesis kut01100   Metabolic pathways kut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kut00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JJ691_70520  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:kut01008]     JJ691_70520 Polyketide biosynthesis proteins [BR:kut01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JJ691_70520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF6255 Motif Other DBs NCBI-ProteinID:  QUQ69296 LinkDB All DBs Position complement(8025275..8025484) Genome browser AA seq 69 aa AA seqDB search MSNPFDNEDGSFFVLVNDEGQHSLWPTFAEVPAGWTRVHGEATRQECLAYVEENWTDLRP KSLIQEVGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgacaacgaggacggctccttcttcgtgctcgtcaacgacgagggc cagcactccctctggccgaccttcgccgaggtgccggccggctggacccgggtgcacggc gaggccacccgccaggagtgcctggcctacgtcgaggagaactggacggacctccgtccc aagagcctcatccaggaagtcggcgcctga

DBGET integrated database retrieval system