Labrenzia sp. THAF35: FIU93_23105 Help Entry FIU93_23105       CDS       T06351                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism labt  Labrenzia sp. THAF35 Pathway labt00261   Monobactam biosynthesis labt01100   Metabolic pathways labt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:labt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FIU93_23105  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:labt01008]     FIU93_23105 Polyketide biosynthesis proteins [BR:labt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FIU93_23105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFT69692 UniProt:  A0A9X7NRA1 LinkDB All DBs Position complement(4937460..4937669) Genome browser AA seq 69 aa AA seqDB search MTNPFDDPDGIFHVLVNDEEQHSLWPEFVPIPDGWRSVFGPGKRQDCVDYVNANWTDIRP KSLRDAALN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccattcgacgatccggacggcattttccatgtgctggtgaatgacgaggaa cagcattctctctggcccgaattcgtgccgatccccgatggctggcggtcggtcttcggc cccggcaagcggcaggactgcgtggactatgtcaacgccaactggaccgacatccgcccg aaaagtcttcgggatgctgccttgaactga

DBGET integrated database retrieval system