Lacinutrix sp. Bg11-31: CW733_12955 Help Entry CW733_12955       CDS       T05225                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism laci  Lacinutrix sp. Bg11-31 Pathway laci00790   Folate biosynthesis laci01100   Metabolic pathways laci01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:laci00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CW733_12955 (folB) Enzymes [BR:laci01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CW733_12955 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CW733_12955 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CW733_12955 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AUC82986 UniProt:  A0A2K8XJK0 LinkDB All DBs Position 2884581..2884943 Genome browser AA seq 120 aa AA seqDB search MGIIKVENIRIHANHGCLKEETAIGSDYRVDLKVKADLEKSASSDALNDTVDYVFLNKVV AEEMATPSALLEHVAKRILRRILSEAKQVSIATVSVSKINPPISGDVEMVTIELTEKRKS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgggaataattaaagttgaaaatatccgcatacatgctaatcatggttgtttaaaagaa gaaacagctattggaagtgattatcgcgtagatttaaaagtaaaagcagatttagagaaa agtgcaagttctgatgctcttaacgatactgtagattacgtttttttaaataaagttgta gcagaagaaatggctactccaagtgcacttttagagcatgttgcaaaacgtattttaaga cgtatattatctgaagctaaacaagttagtatagcaactgtttctgtaagtaaaattaat ccacctattagtggagacgttgaaatggttactattgaattaactgaaaaaagaaaaagt taa

DBGET integrated database retrieval system