Lacibacter sediminis: H4075_13065 Help Entry H4075_13065       CDS       T06746                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lacs  Lacibacter sediminis Pathway lacs00790   Folate biosynthesis lacs01100   Metabolic pathways lacs01240   Biosynthesis of cofactors Module lacs_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:lacs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     H4075_13065 (folB) Enzymes [BR:lacs01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      H4075_13065 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      H4075_13065 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      H4075_13065 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB NusA_N Motif Other DBs NCBI-ProteinID:  QNA43018 UniProt:  A0A7G5XC15 LinkDB All DBs Position complement(3081044..3081406) Genome browser AA seq 120 aa AA seqDB search MIAVHLKELKFHAHHGLYAGEDKTGGPFEVNLSVYYEPAGPITSIEQTINYVALFEIVKQ RMMQKSSLIETVAQDICDTIKTRFPVIMEIKVEIDKCSPPIENFQGKTGITLHKTFNRIT NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgatagctgttcatttaaaagagttgaaatttcatgcacaccatggtttatatgccgga gaagataaaacaggcggaccgtttgaagtaaatctttcggtgtattatgaacctgccggg ccaatcacatctatcgagcaaacaatcaattatgttgctttgtttgagattgtgaagcaa cgaatgatgcaaaaaagcagtctgatagaaacagtggcgcaggatatttgtgatacgatt aagacccgttttcccgttattatggaaataaaggtggaaattgataagtgttcgccaccc attgaaaactttcaaggtaaaaccggcataaccttgcataaaacatttaaccggatcaca tga

DBGET integrated database retrieval system