Lysobacter auxotrophicus: LA521A_32080 Help Entry LA521A_32080      CDS       T09075                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism laux  Lysobacter auxotrophicus Pathway laux00290   Valine, leucine and isoleucine biosynthesis laux00650   Butanoate metabolism laux00660   C5-Branched dibasic acid metabolism laux00770   Pantothenate and CoA biosynthesis laux01100   Metabolic pathways laux01110   Biosynthesis of secondary metabolites laux01210   2-Oxocarboxylic acid metabolism laux01230   Biosynthesis of amino acids Module laux_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine laux_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:laux00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     LA521A_32080    00660 C5-Branched dibasic acid metabolism     LA521A_32080   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     LA521A_32080   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     LA521A_32080 Enzymes [BR:laux01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      LA521A_32080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 DUF3710 SbcD_C Penicil_amidase Motif Other DBs NCBI-ProteinID:  BDU18007 LinkDB All DBs Position 3600306..3600542 Genome browser AA seq 78 aa AA seqDB search MRYQLDLTLRQAEGALSRVLGAAERRGFRPLAVDGEAQSDGDRWHLRLTVEGERDEVNLQ HQLEKLYDCLAVEVSPCR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcgataccagcttgatctcacgctccgtcaggccgaaggcgcgctgtcgcgggtactg ggcgccgccgaacgccgcggtttccgtccgctcgccgtcgatggcgaagcgcagtccgac ggcgaccgctggcacctgcgcctgaccgtcgagggcgaacgcgacgaagtcaacctgcag caccagctcgagaagctgtacgactgcctcgcggtggaggtgtcgccatgtcggtga

DBGET integrated database retrieval system