Leptosomus discolor (cuckoo roller): 104341412 Help Entry 104341412         CDS       T08399                                  Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi00860   Porphyrin metabolism ldi04216   Ferroptosis ldi04217   Necroptosis Brite KEGG Orthology (KO) [BR:ldi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     104341412  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     104341412    04217 Necroptosis     104341412  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ldi04147]     104341412 Enzymes [BR:ldi01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      104341412 Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104341412   Exosomal proteins of bladder cancer cells    104341412 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin YppF Motif Other DBs NCBI-GeneID:  104341412 NCBI-ProteinID:  XP_009953441 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECALHLEKNVNQSLLELHKLATEKNDPHL CDFIETHYLDEQVKSIKELGDHVTNLRKMGAPKYGMAEYLFDKHTLGDSDNES NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaagctacaaaaccagaggggcggacgcatcttcttgcaggacatcaagaagccagat cgtgatgactgggaaaacggactgactgcaatggagtgtgccctgcacctggaaaaaaat gtgaaccagtcactgctggagctgcacaaattggcaaccgaaaagaatgacccacatttg tgtgacttcattgagactcactacctggatgaacaggtgaaatccatcaaagagctgggt gaccatgtgaccaacctgcggaagatgggggcaccgaaatatggcatggcagagtacctc tttgacaagcacaccctaggggacagtgacaatgagagctga

DBGET integrated database retrieval system