Lentzea guizhouensis: BBK82_28220 Help Entry BBK82_28220       CDS       T04448                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism led  Lentzea guizhouensis Pathway led00261   Monobactam biosynthesis led01100   Metabolic pathways led01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:led00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBK82_28220  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:led01008]     BBK82_28220 Polyketide biosynthesis proteins [BR:led01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBK82_28220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANZ39360 UniProt:  A0A1B2HNR7 LinkDB All DBs Position 5747594..5747788 Genome browser AA seq 64 aa AA seqDB search MTNPFEDPQGRFFVLVNEEQQHSLWPAFAEVPAGWTTVFGEESREACLAYVEENWTDMRP LSIR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgaggacccgcagggccggttcttcgtgctggtcaacgaagagcag cagcactcgctgtggccggcgttcgcggaggtgcccgccgggtggaccacggtgttcggc gaggagagccgcgaggcgtgcctggcctacgtcgaggagaactggaccgacatgaggccc ctctccatccgctga

DBGET integrated database retrieval system