Leptolinea sp. HRD-7: hrd7_10990 Help Entry hrd7_10990        CDS       T08293                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism lek  Leptolinea sp. HRD-7 Pathway lek00020   Citrate cycle (TCA cycle) lek01100   Metabolic pathways lek01110   Biosynthesis of secondary metabolites lek01120   Microbial metabolism in diverse environments lek01200   Carbon metabolism lek01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:lek00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     hrd7_10990 Enzymes [BR:lek01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      hrd7_10990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_22 Fer4_15 Fer4_17 Fer4_8 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  BCY17250 LinkDB All DBs Position complement(1200144..1200380) Genome browser AA seq 78 aa AA seqDB search MPPKGRIEVNEDLCKGCELCVANCPQEVIALNMERLTKRGYHPADLAKEGCTGCGICAIV CPEAAITVYREVVHKQPA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcccccaaagggtcgaatagaagtaaacgaagacctctgcaaaggttgtgagttgtgt gtggcgaattgtcctcaggaagtcatcgcgttaaatatggaacgtctgaccaagagaggc taccatcccgctgatctggctaaagagggatgcacaggttgcggtatctgtgccattgta tgccccgaagccgccattactgtctaccgtgaagttgtgcataaacaaccagcctag

DBGET integrated database retrieval system