Lentibacillus sp. CBA3610: Len3610_16165 Help Entry Len3610_16165     CDS       T08606                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lex  Lentibacillus sp. CBA3610 Pathway lex00790   Folate biosynthesis lex01100   Metabolic pathways lex01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:lex00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Len3610_16165 (folB) Enzymes [BR:lex01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Len3610_16165 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Len3610_16165 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Len3610_16165 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB HasA Motif Other DBs NCBI-ProteinID:  QKY70914 UniProt:  A0A7H8SAI4 LinkDB All DBs Position 3300287..3300652 Genome browser AA seq 121 aa AA seqDB search MDKILLNQMMFYGYHGLFPEENKLGQRFLVDTELMLDLKKSSRSDDMHDSIDYGEVYHVI KEIMEGEPKNLVEAIAEAIADELFQSFNLLKACKLTVTKPDPPIPGHYQSVAVEIYRERN E NT seq 366 nt NT seq  +upstreamnt  +downstreamnt ttggataaaattttgctgaatcaaatgatgttttacggataccatggcctgtttccggaa gagaacaaactcggccagcgatttttggttgatacagagctgatgctggatttgaaaaag tccagccgttcggatgatatgcatgattcgattgattatggcgaagtttatcatgtcatc aaagagattatggaaggcgaaccgaaaaatctggttgaggcgattgctgaggcgattgct gatgaattatttcaatcgtttaatttactaaaagcttgcaaattaacggttaccaagcca gaccctcctataccgggacattaccagtcagttgcagtcgaaatataccgggagcgaaac gaatga

DBGET integrated database retrieval system