Lysobacter enzymogenes C3: GLE_0311 Help Entry GLE_0311          CDS       T04371                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lez  Lysobacter enzymogenes C3 Pathway lez00790   Folate biosynthesis lez01100   Metabolic pathways lez01240   Biosynthesis of cofactors Module lez_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:lez00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GLE_0311 (folB) Enzymes [BR:lez01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GLE_0311 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GLE_0311 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GLE_0311 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ALN55669 UniProt:  A0A0S2DAW1 LinkDB All DBs Position 341519..341881 Genome browser AA seq 120 aa AA seqDB search MDHVFIEGLEIEAVIGIYDWEREIRQPLVFDLEMAFDNAVPAASDAIEHTLDYAAVCARI TAFVAESRFGLVETLAERVAAIVIEEFGVRRVALKLTKPGAIRNARGVGVRIVREAAARP NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggaccacgtattcatcgaaggcctggaaatcgaggccgtcatcggcatctacgactgg gagcgcgagatccgccagccgctcgtgttcgatctggagatggctttcgacaacgccgtg ccggccgccagcgacgcgatcgagcacaccctcgactacgccgcggtgtgcgcgcgcatc accgcgttcgtcgccgaatcgcgcttcggcctggtcgagaccctggccgagcgggtcgcg gcgatcgtgatcgaggaattcggcgtgcgccgggtcgcgctcaagctgaccaagcccggc gcgatccgcaacgcgcgcggcgtcggcgtgcgcatcgtgcgcgaggccgcggctcggccg taa

DBGET integrated database retrieval system