Lactobacillus helveticus H9: LBH_0971 Help Entry LBH_0971          CDS       T03040                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lhh  Lactobacillus helveticus H9 Pathway lhh00790   Folate biosynthesis lhh01100   Metabolic pathways lhh01240   Biosynthesis of cofactors Module lhh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:lhh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LBH_0971 Enzymes [BR:lhh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LBH_0971  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LBH_0971  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LBH_0971 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB GPW_gp25 Motif Other DBs NCBI-ProteinID:  AHI11973 LinkDB All DBs Position 1016738..1017121 Genome browser AA seq 127 aa AA seqDB search MLYLEIRGVFVMYTIRVQNMQFHGHIGVLPEEKKVGQPLQVDLEAVINAVPVADQLASTV SYGDFYPIVEKIIDENHVNLVETLAQKILTAIKQLDSRIQTVTVRIRKLNLPVDGVFNNV EIEMKQS NT seq 384 nt NT seq  +upstreamnt  +downstreamnt ttgttgtatttagaaatacgaggagtttttgttatgtatacgatcagagttcaaaatatg cagtttcatgggcacattggcgtcctgccggaagaaaagaaggttggccaaccccttcaa gttgatttggaagcggtcattaatgcagtgccggttgccgatcaattagcaagcacggtt agttatggagacttctatccgattgttgaaaaaattattgatgaaaatcacgtcaatctg gttgaaacactggctcagaaaattttaactgctattaagcaattggatagtcggattcag acggtcactgttcgaatccgtaaattaaacttaccggttgacggcgtctttaataatgtg gaaatcgagatgaaacaatcatga

DBGET integrated database retrieval system