Listeria ivanovii WSLC3009: AX25_01245 Help Entry AX25_01245        CDS       T03045                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism liw  Listeria ivanovii WSLC3009 Pathway liw00790   Folate biosynthesis liw01100   Metabolic pathways liw01240   Biosynthesis of cofactors Module liw_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:liw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AX25_01245 Enzymes [BR:liw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AX25_01245  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AX25_01245  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AX25_01245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AHI54809 LinkDB All DBs Position 273085..273459 Genome browser AA seq 124 aa AA seqDB search MDKIYLNELAFYGYHGVLSEENKLGQKFSVSLILGLSTKNAGNSDDVNDTVSYADVYETV KTIVEGKPFNLIEALAEKIAIEVLKNYPLLKEVTVKLIKPNPPIPGHYHSVAVEIERKRS ELNG NT seq 375 nt NT seq  +upstreamnt  +downstreamnt ttggataaaatatacttaaatgaactagcattttatggttatcatggtgttttgtcagaa gaaaataagctgggtcaaaaatttagcgtatcattaatccttggtctttcaacaaaaaat gcagggaattctgatgatgtaaacgatactgttagctatgcagatgtctatgaaacggtg aaaacaatagtagaaggaaaaccgtttaatttaattgaggcacttgcggaaaaaattgca atagaagttttaaagaattatccgcttcttaaggaagtgacggtgaaattaattaaacct aatccgccaattccaggacattatcattctgtggcagtggaaatcgaacgaaaaagaagt gaactgaatggctaa

DBGET integrated database retrieval system