Leuconostoc lactis: BCR17_06615 Help Entry BCR17_06615       CDS       T04460                                  Name (GenBank) hypothetical protein   KO K00640   serine O-acetyltransferase [EC:2.3.1.30] Organism llf  Leuconostoc lactis Pathway llf00270   Cysteine and methionine metabolism llf00543   Exopolysaccharide biosynthesis llf00920   Sulfur metabolism llf01100   Metabolic pathways llf01110   Biosynthesis of secondary metabolites llf01120   Microbial metabolism in diverse environments llf01200   Carbon metabolism llf01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:llf00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     BCR17_06615   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     BCR17_06615   09107 Glycan biosynthesis and metabolism    00543 Exopolysaccharide biosynthesis     BCR17_06615 Enzymes [BR:llf01000]  2. Transferases   2.3  Acyltransferases    2.3.1  Transferring groups other than aminoacyl groups     2.3.1.30  serine O-acetyltransferase      BCR17_06615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hexapep Hexapep_2 Motif Other DBs NCBI-ProteinID:  ANY12470 LinkDB All DBs Position 1344078..1344362 Genome browser AA seq 94 aa AA seqDB search MPNLPHGLVGIFIHPSVKIGKNVTIYQQVTIGENGFGSEAAVIGDNVVIGAGAKIIGSVN IGNDVIIGANAVVTKDISKNQVVGGIPATILYSK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atacctaatttaccacacgggctagttggaatatttattcacccttcagtcaagattgga aaaaatgttacgatataccagcaagtaactattggagaaaatggttttggtagtgaagct gcagttattggtgataatgtagtgattggtgcgggtgcgaaaattattggatcagtaaat attggtaacgatgttatcattggggctaacgcagttgtgacaaaagatatatctaaaaac caagttgttggaggtatacctgcaacaattctgtatagcaaatag

DBGET integrated database retrieval system