Lysobacter luteus: LYB30171_00300 Help Entry LYB30171_00300    CDS       T08395                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism llz  Lysobacter luteus Pathway llz00790   Folate biosynthesis llz01100   Metabolic pathways llz01240   Biosynthesis of cofactors Module llz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:llz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LYB30171_00300 (folB) Enzymes [BR:llz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LYB30171_00300 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LYB30171_00300 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LYB30171_00300 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CAG4968570 LinkDB All DBs Position 1:324266..324631 Genome browser AA seq 121 aa AA seqDB search MDKVFIEGLEIEALIGIYDWERRIRQALVFDIEMSFDNRIPAASDAIEDTLNYKAVSKRV IEFVSGSGYGLVETLAEKVAAIILDEFAVSHVRLKLSKPGAVRGARAVGVIIERSAATLA R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggacaaggtattcatcgaaggcctcgagatcgaggcgctgatcggcatctacgactgg gagcgacgcatccgccaggcgctggtgttcgatatcgagatgtcgttcgacaaccgcatc cccgccgccagtgacgcaatcgaggacaccctcaactacaaggcggtcagcaagcgggtg atcgagttcgtgtccgggtccggctacgggctggtcgagacgctggcggagaaagtcgcg gcgatcatcctcgacgaattcgcggtgtcgcacgttcggctcaagctcagcaagccgggc gcggtgcgcggtgcgcgcgcggtcggggtgatcatcgagcgttcggccgctacccttgcc cgatga

DBGET integrated database retrieval system