Listeria marthii: LAX80_001000 Help Entry LAX80_001000      CDS       T07828                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lmar  Listeria marthii Pathway lmar00790   Folate biosynthesis lmar01100   Metabolic pathways lmar01240   Biosynthesis of cofactors Module lmar_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:lmar00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LAX80_001000 (folB) Enzymes [BR:lmar01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LAX80_001000 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LAX80_001000 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LAX80_001000 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  UHP10406 LinkDB All DBs Position 215743..216117 Genome browser AA seq 124 aa AA seqDB search MDKIYLNELVFYGYHGVLAEETKLGQTFRVSLILGLSTKKAGMSDSVDDTVSYAEVYETV KEIVEGTPFKLIEALAEKIASEVLGGYPLLEEVTVKLIKPNPPIPGHYDSVAVEIERKRS DLNG NT seq 375 nt NT seq  +upstreamnt  +downstreamnt ttggataaaatttatttaaatgagttagtgttttacggataccacggagttttagcagaa gaaacaaaattaggacaaacgttcagagtgtcgctaattcttggactttctaccaaaaaa gcgggaatgtcagatagcgttgatgatacagtcagttatgcagaagtatatgaaacagta aaagaaatcgtagaaggaacgccatttaagctaattgaagctcttgcagaaaaaatcgcc agcgaggttttgggtggttatccacttttagaagaagtaactgtaaagcttattaaaccc aatccgccaattccggggcattatgattccgttgccgttgaaatcgagcgtaagagaagt gatttgaatggctag

DBGET integrated database retrieval system