Limosilactobacillus reuteri I5007: LRI_0686 Help Entry LRI_0686          CDS       T02701                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lrt  Limosilactobacillus reuteri I5007 Pathway lrt00790   Folate biosynthesis lrt01100   Metabolic pathways lrt01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:lrt00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LRI_0686 Enzymes [BR:lrt01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LRI_0686  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LRI_0686  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LRI_0686 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGN98895 UniProt:  R9WJW3 LinkDB All DBs Position 704215..704550 Genome browser AA seq 111 aa AA seqDB search MAFNTYNGVFAEEKKLGQKIEIDCEMDYPIETMVRTDELDETVSYADVYETIAEFVAHHN YNLIESLANNLLRELFKTYPMLDGVRLRIRKYSVPIAGIFDNVEIEVAGSK NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcatttaatacttacaatggtgtgtttgcggaagagaaaaagcttggtcaaaaaatt gagattgactgtgagatggactatccaattgaaacgatggttagaaccgatgaattagat gagaccgtcagttacgctgatgtttatgaaacaattgcggagtttgttgcccaccacaac tataatttgattgagagtctcgctaataacttactgcgcgagcttttcaagacatacccg atgcttgatggggttcgccttcgcatccgtaaatatagtgtgccgattgccgggattttc gataatgtcgaaattgaagtagcagggagcaaataa

DBGET integrated database retrieval system