Legionella sainthelensi: CAB17_17860 Help Entry CAB17_17860       CDS       T05293                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lsh  Legionella sainthelensi Pathway lsh00790   Folate biosynthesis lsh01100   Metabolic pathways lsh01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:lsh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CAB17_17860 (folB) Enzymes [BR:lsh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CAB17_17860 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CAB17_17860 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CAB17_17860 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AUH73698 UniProt:  A0A0W0YCJ7 LinkDB All DBs Position 2558012..2558350 Genome browser AA seq 112 aa AA seqDB search MDTLNIKALKVSTKIGVYEWEQRINQHLLIDINIDTDFSACGEDLTKTIDYEALCERVTL HVESKSFQLIETVANEVATLIQEQFKITHLTIGVSKPHAIKNAENIQVIVRR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggataccttaaacataaaagccctcaaggtcagtacaaaaataggcgtgtatgaatgg gaacaacgtatcaatcaacacttattaattgatatcaatattgatactgatttcagtgct tgcggagaagatttaactaaaacaattgattatgaagccctttgtgaacgggttaccctg cacgtagaatcaaaatcatttcaattaattgaaacagttgccaatgaagtggccacccta attcaagaacaatttaaaataacgcaccttacaataggcgtaagcaaaccacatgcaata aaaaatgcggaaaatattcaggtgattgtgcgtcgttaa

DBGET integrated database retrieval system