Lutibacter profundi: Lupro_04515 Help Entry Lupro_04515       CDS       T04235                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism lut  Lutibacter profundi Pathway lut00020   Citrate cycle (TCA cycle) lut01100   Metabolic pathways lut01110   Biosynthesis of secondary metabolites lut01120   Microbial metabolism in diverse environments lut01200   Carbon metabolism lut01210   2-Oxocarboxylic acid metabolism Module lut_M00009   Citrate cycle (TCA cycle, Krebs cycle) lut_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:lut00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Lupro_04515 Enzymes [BR:lut01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Lupro_04515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_6 Fer4_2 Fer4_16 Fer4_9 Fer4_4 Fer4_22 Fer4_15 Fer4_17 Fer4_13 Fer4_3 Fer4_8 Motif Other DBs NCBI-ProteinID:  AMC10548 UniProt:  A0A0X8G5T0 LinkDB All DBs Position 1027883..1028113 Genome browser AA seq 76 aa AA seqDB search MAKVKGAIVVDTETCKGCEVCIPVCPENVISMSTEVNRKGYHYAYMSNPEVCTGCTNCGI VCPDRAISVYRVKVSA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagttaaaggtgcaattgtagttgatactgaaacttgtaaaggttgtgaagtt tgtatacctgtttgtcctgaaaacgtgataagtatgtctacagaagttaacagaaaaggt tatcattatgcctatatgagcaaccctgaagtttgtactgggtgtacaaattgtggtata gtttgtcctgatagggcaatatcagtatacagagttaaagtatctgcataa

DBGET integrated database retrieval system