Leptonychotes weddellii (Weddell seal): 102727282 Help Entry 102727282         CDS       T08708                                  Symbol FTH1 Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww00860   Porphyrin metabolism lww04216   Ferroptosis lww04217   Necroptosis lww04978   Mineral absorption Brite KEGG Orthology (KO) [BR:lww00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     102727282 (FTH1)  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     102727282 (FTH1)    04217 Necroptosis     102727282 (FTH1)  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102727282 (FTH1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102727282 (FTH1) Enzymes [BR:lww01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      102727282 (FTH1) Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102727282 (FTH1)   Exosomal proteins of bladder cancer cells    102727282 (FTH1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  102727282 NCBI-ProteinID:  XP_030880667 UniProt:  A0A7F8QHG2 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MKLQNQRGGRIFLQDIKKPDRDDWENGLNAMECALHLEKSVNQSLLELHKLATDKSDPHL CDFIETHYLNEQVKSIKELGDHVTNLRKMGFPGV NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagctgcagaaccaacgaggtggccgaatcttccttcaggatatcaagaaaccagac cgtgatgattgggagaacgggctgaatgcaatggagtgtgcattacacttggagaagagc gtgaatcagtcactactggaactgcacaaactggccactgataaaagtgacccccatttg tgtgacttcattgagactcactacctgaatgagcaggtgaaatccatcaaagaattgggt gaccacgtaaccaacctgcgcaagatggggttcccaggagtctaa

DBGET integrated database retrieval system