Leptonychotes weddellii (Weddell seal): 102739872 Help Entry 102739872         CDS       T08708                                  Name (RefSeq) ferritin heavy chain-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww00860   Porphyrin metabolism lww04216   Ferroptosis lww04217   Necroptosis lww04978   Mineral absorption Brite KEGG Orthology (KO) [BR:lww00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     102739872  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     102739872    04217 Necroptosis     102739872  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102739872  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102739872 Enzymes [BR:lww01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      102739872 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102739872   Exosomal proteins of bladder cancer cells    102739872 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  102739872 NCBI-ProteinID:  XP_030878782 UniProt:  A0A7F8QC35 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search DRDDWESGLKAMECALHLEKSVNQCLLDLHQLATDKNDAHLCDFLESHYLHEQVKSIKEL GGYVNSLCKMGAPDAGMAEYLFDKLTLGDSDKKN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gaccgcgacgactgggagagcggcctgaaggccatggagtgcgccctgcacctggagaag agcgtgaaccagtgcctgctcgacctgcaccagctggccaccgacaagaacgacgcccac ctgtgcgacttcctggagagccactacctgcacgagcaagtcaagtccatcaaagagctg gggggctatgtcaacagcctgtgcaagatgggggccccggatgccggcatggcagagtac ctctttgacaagctcaccctgggcgacagcgacaaaaagaactga

DBGET integrated database retrieval system