Lysinibacillus sp. 2017: DCE79_00480 Help Entry DCE79_00480       CDS       T05455                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lyz  Lysinibacillus sp. 2017 Pathway lyz00790   Folate biosynthesis lyz01100   Metabolic pathways lyz01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:lyz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     DCE79_00480 (folB) Enzymes [BR:lyz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      DCE79_00480 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      DCE79_00480 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      DCE79_00480 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AWE05977 UniProt:  A0A2S1GX74 LinkDB All DBs Position 101131..101499 Genome browser AA seq 122 aa AA seqDB search MDYIHLRDMQFFGYHGVLPEETRLGQRFRANVSLAVDIKRAGETDELDDTVSYVGVYDIC KEIIEGQPYKLIEAVAETIATRILTQYEGQVFGCRVEVVKPDPPIPGHYKEVAVEIVRGT FS NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggattatattcatttaagagatatgcagtttttcgggtatcacggtgtgttgccagaa gaaacgagattaggtcaacgctttcgtgccaatgtttcacttgctgttgatataaaacgt gcaggggaaacagatgagctagatgacacagttagttatgtaggcgtttatgatatttgt aaagaaattatcgagggtcaaccatataaattaatcgaagccgttgcagaaacaattgca acacgcattttaacacagtatgaaggtcaagtatttggttgccgtgtagaagtggtaaaa ccagaccctccgattcctggacattataaagaagtagctgttgaaattgtgcgaggtacg ttttcatga

DBGET integrated database retrieval system