Mycobacterium adipatum: A7U43_12695 Help Entry A7U43_12695       CDS       T09402                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism madi  Mycobacterium adipatum Pathway madi00261   Monobactam biosynthesis madi01100   Metabolic pathways madi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:madi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A7U43_12695  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:madi01008]     A7U43_12695 Polyketide biosynthesis proteins [BR:madi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A7U43_12695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANE80058 UniProt:  A0A172UMC1 LinkDB All DBs Position 2684009..2684218 Genome browser AA seq 69 aa AA seqDB search MSNNPFDDEDGTFYVLMNDEEQHSLWPTFAEFPAGWRVVFGESSRADCLAYVEENWSDLR PRSLRDAMS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaacccgttcgatgacgaggacggcaccttctacgtcctgatgaacgacgag gagcaacacagcctgtggccgaccttcgccgagttcccggccgggtggcgggtcgtgttc ggggagagcagccgagcggactgcctggcctatgtggaggagaactggtcggacctgcgg cccagaagcctgcgcgacgccatgtcctaa

DBGET integrated database retrieval system