Metarhizium robertsii: MAA_00683 Help Entry MAA_00683         CDS       T03107                                  Name (RefSeq) RNA polymerase, subunit N/RPB10   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism maj  Metarhizium robertsii Pathway maj03020   RNA polymerase maj03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:maj00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MAA_00683   09124 Replication and repair    03420 Nucleotide excision repair     MAA_00683  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:maj03021]     MAA_00683    03400 DNA repair and recombination proteins [BR:maj03400]     MAA_00683 Transcription machinery [BR:maj03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MAA_00683   RNA polymerase III system    RNA polymerase III      MAA_00683   RNA polymerase I system    RNA polymerase I      MAA_00683 DNA repair and recombination proteins [BR:maj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MAA_00683 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  19254969 NCBI-ProteinID:  XP_007816872 UniProt:  E9EMH6 LinkDB All DBs AA seq 79 aa AA seqDB search MIIPIRCFSCGKVTGDLWERYLQLIADPRKTDGDAMDELGLKRYCCRRMIMTHVDLIEKL LKYTPDGRNEKKQRLNELA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgattattcctatacgttgcttctcctgcggaaaggtcacgggggacctttgggagcgg tatctccaactcatcgcggatccgagaaaaactgatggtgatgccatggacgaacttggt ttgaagcgttattgctgtcgtcgcatgatcatgacccacgtcgacctcatcgagaaactg ctcaaatatacaccagacggtcgaaacgagaagaagcaacggctcaatgaactggcatga

DBGET integrated database retrieval system