Mameliella alba: KU6B_19210 Help Entry KU6B_19210        CDS       T06509                                  Name (GenBank) hypothetical protein   KO K01799   maleate isomerase [EC:5.2.1.1] Organism malu  Mameliella alba Pathway malu00650   Butanoate metabolism malu00760   Nicotinate and nicotinamide metabolism malu01100   Metabolic pathways malu01120   Microbial metabolism in diverse environments Brite KEGG Orthology (KO) [BR:malu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     KU6B_19210   09108 Metabolism of cofactors and vitamins    00760 Nicotinate and nicotinamide metabolism     KU6B_19210 Enzymes [BR:malu01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.1  maleate isomerase      KU6B_19210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Amdase Motif Other DBs NCBI-ProteinID:  BBU55656 UniProt:  A0A6F8Q525 LinkDB All DBs Position 1899267..1899554 Genome browser AA seq 95 aa AA seqDB search MLDRKAIGIVANREVGRLDASTELDLGAEIDRPDADSIMQACGNWKTFPINEELEARTGT PVLTTNQVSLWHVARMLGLPPVNGLGRSLAGKTPA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgctggaccggaaggccatcggcatcgtggcaaaccgcgaggtgggccgcctggacgcc tctaccgagctggacctgggcgccgagatcgaccgccccgacgcggattcgatcatgcag gcctgcggcaactggaagacctttccgatcaacgaagagctggaagccaggaccggcacg ccggtgttgaccaccaaccaggtcagcctctggcatgtcgccaggatgcttggcctgccg ccggtgaacggcctgggccggtcgctggcgggcaagaccccggcctga

DBGET integrated database retrieval system