Mycolicibacterium alvei: MALV_00850 Help Entry MALV_00850        CDS       T06961                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism malv  Mycolicibacterium alvei Pathway malv00261   Monobactam biosynthesis malv01100   Metabolic pathways malv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:malv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MALV_00850  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:malv01008]     MALV_00850 Polyketide biosynthesis proteins [BR:malv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MALV_00850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBX24960 UniProt:  A0A6N4UJH4 LinkDB All DBs Position 96377..96589 Genome browser AA seq 70 aa AA seqDB search MSSNPFDDENGTFYVLANDEDQHSLWPAFAEVPSGWRVAFGGSSRDECLSYVEQTWTDIR PRSLREATRN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagttccaatccgttcgatgacgagaacggcacgttctatgtcctggcgaacgatgag gaccagcacagcctgtggccggcgttcgccgaggttccgtcgggctggcgggtggccttc ggcgggagcagtcgggacgagtgcctgagctacgtcgagcagacctggaccgatattcgg cccaggagcctgcgtgaggcgacgagaaactga

DBGET integrated database retrieval system