Mangrovimonas sp. YM274: RBH95_01005 Help Entry RBH95_01005       CDS       T09317                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mang  Mangrovimonas sp. YM274 Pathway mang00790   Folate biosynthesis mang01100   Metabolic pathways mang01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mang00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RBH95_01005 (folB) Enzymes [BR:mang01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      RBH95_01005 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      RBH95_01005 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      RBH95_01005 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  WMI68963 UniProt:  A0AA51GLW5 LinkDB All DBs Position 214166..214534 Genome browser AA seq 122 aa AA seqDB search MGIIKVENIRVFANHGCLKEETKIGSDYRVDLKIKANLQASAQSDDLGDTVDYVLLNKIV REEMHQPSHLLETVAKRIIVRILKEDPLVTKATVWVSKLNPPIGGDVEMVTIKMTERRKN LQ NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggaatcattaaagttgaaaacatccgtgtatttgccaaccatggttgcttaaaggaa gaaaccaaaataggcagtgattatcgagtagatttaaagataaaagccaatttgcaggca tcggcacaatctgatgaccttggagatacggtagattatgtccttttaaacaaaattgta agggaagaaatgcaccaaccttcacatttattggaaaccgttgccaaacgtatcatagtg cgcatattaaaggaagatccactagtcacaaaagctacggtttgggtgagtaaattgaac cctcctattggcggtgatgtagaaatggtgacaataaaaatgactgaaagacgaaaaaat ttgcagtaa

DBGET integrated database retrieval system