Methanomicrobium antiquum: L1994_02505 Help Entry L1994_02505       CDS       T08973                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism manq  Methanomicrobium antiquum Pathway manq00020   Citrate cycle (TCA cycle) manq00720   Carbon fixation pathways in prokaryotes manq01100   Metabolic pathways manq01110   Biosynthesis of secondary metabolites manq01120   Microbial metabolism in diverse environments manq01200   Carbon metabolism manq01210   2-Oxocarboxylic acid metabolism Module manq_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:manq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L1994_02505   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     L1994_02505 Enzymes [BR:manq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L1994_02505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_3 Fer4_13 Fer4_8 Fer4_17 Fer4_22 Motif Other DBs NCBI-ProteinID:  WFN37278 LinkDB All DBs Position 516176..516448 Genome browser AA seq 90 aa AA seqDB search MKLIIDESRCKGCNLCTLVCPYNIFQEGSELNSKGIVVPSLDRPGRCTNCRLSKLYQRRL CGVCQLICPDQAIHWVEEEPYEPLGVVIEF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaactaattattgatgagagtcgctgtaaaggatgcaatctctgtacacttgtctgc ccatataatatatttcaggaaggatcagaattaaacagcaaaggaattgttgttccttcc cttgacagacccggcaggtgtacaaactgcaggctttccaaattatatcagaggcgtttg tgtggcgtatgccagttaatctgccctgatcaggctattcactgggttgaggaagagcct tatgaacctcttggagtggtgatagagttttga

DBGET integrated database retrieval system