Maribacter sp. MJ134: EJ994_13180 Help Entry EJ994_13180       CDS       T05877                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mare  Maribacter sp. MJ134 Pathway mare00790   Folate biosynthesis mare01100   Metabolic pathways mare01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mare00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EJ994_13180 (folB) Enzymes [BR:mare01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      EJ994_13180 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      EJ994_13180 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      EJ994_13180 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Gemini_C4 Motif Other DBs NCBI-ProteinID:  AZQ59707 UniProt:  A0A3Q9FKX9 LinkDB All DBs Position complement(3045638..3045997) Genome browser AA seq 119 aa AA seqDB search MGTVLVENIRVYAYHGCLPQETRLGSDYLVNISVKADLSKAAATDSLEDTVDYVHINHIV KEEMAIPSKLLEHVAQRINGRIFKELPTVKTSKVAVSKVNPPINGDVEKVTVTLKSKRT NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgggaacagtccttgtagaaaacataagagtttacgcctatcacggttgcctacctcaa gaaacgcggttaggaagcgattatctagtgaatatctcagtgaaagcggacttgtccaaa gccgctgctacggatagtcttgaagataccgtggattatgttcatataaaccatatcgta aaagaggaaatggccataccttccaaacttttagaacatgtagctcaaagaataaacggg cgcatatttaaagagctaccaactgttaaaacttcaaaagtagcggtatccaaagtaaac cctcctataaacggtgatgttgaaaaagttacggtaaccttaaaatcaaaaagaacgtga

DBGET integrated database retrieval system