Marinobacter sp. CP1: ACP86_12735 Help Entry ACP86_12735       CDS       T04052                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mari  Marinobacter sp. CP1 Pathway mari00790   Folate biosynthesis mari01100   Metabolic pathways mari01240   Biosynthesis of cofactors Module mari_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mari00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ACP86_12735 (folB) Enzymes [BR:mari01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ACP86_12735 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ACP86_12735 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ACP86_12735 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AKV96957 UniProt:  A0A0K1UB29 LinkDB All DBs Position 2766907..2767281 Genome browser AA seq 124 aa AA seqDB search MADNVLIEGLAVETVVGVYDWEREVTQSLVVDLEMAWDNTVPGRSDDVADALDYAAVSAR VESCLQTLRPKLLEHGAEVLARTLREEFGIKWLRLAIRKPGAVPAAQAVGVRIERGENTE TGVR NT seq 375 nt NT seq  +upstreamnt  +downstreamnt ttggcagacaatgtattgatcgaaggcctggctgtggaaactgtggttggtgtttatgac tgggagcgggaagtcacccagagcctggtggttgatctggaaatggcctgggataacacg gtaccgggccgctcggacgacgtcgccgatgccctggattacgcggccgtcagtgcccgg gtcgagtcctgcctgcagacgctcaggccaaaactgcttgagcatggggcggaggtcctc gccagaaccttgcgggaggaattcggcatcaagtggttacgactggcgatacgtaagccg ggcgccgtacccgcggcacaggcggtgggcgttcggatcgagcggggagagaacactgag acaggagtgcggtaa

DBGET integrated database retrieval system