Myxocyprinus asiaticus (Chinese sucker): 127434207 Help Entry 127434207         CDS       T08782                                  Name (RefSeq) ferritin, lower subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi00860   Porphyrin metabolism masi04216   Ferroptosis masi04217   Necroptosis Brite KEGG Orthology (KO) [BR:masi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     127434207  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     127434207    04217 Necroptosis     127434207  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127434207 Enzymes [BR:masi01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      127434207 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127434207   Exosomal proteins of bladder cancer cells    127434207 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin NitrOD2 Motif Other DBs NCBI-GeneID:  127434207 NCBI-ProteinID:  XP_051542734 LinkDB All DBs Position 44:2503818..2507856 Genome browser AA seq 99 aa AA seqDB search MHIAPYAQKPSRDDWRGGMDAITFSLEYQKSLNRSLLEIHQAAGENSDPHQCDFLEHHFL TDSHDTIKKLGDHAGSLTCLISSDPHGMMGEYLFDKHTL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcatatcgccccctatgcacagaagcctagtcgggatgattggaggggaggtatggat gccatcactttctctctggaatatcagaaatccctcaacagatccttgctggagatccat caagcagctggagaaaactctgaccctcatcagtgtgatttcctagagcaccacttcttg actgacagtcatgacaccataaagaagctgggtgaccatgccggcagcctgacttgcctc atctcttctgacccgcatggaatgatgggagagtatctgttcgacaagcacactctctga

DBGET integrated database retrieval system