Micromonospora aurantiaca: Micau_2788 Help Entry Micau_2788        CDS       T01296                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism mau  Micromonospora aurantiaca Pathway mau00261   Monobactam biosynthesis mau01100   Metabolic pathways mau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Micau_2788  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mau01008]     Micau_2788 Polyketide biosynthesis proteins [BR:mau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Micau_2788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADL46323 UniProt:  D9T9A1 LinkDB All DBs Position 3185334..3185522 Genome browser AA seq 62 aa AA seqDB search MAEPRFLVVRNDEEQYSIWSADRDLPAGWHDTGFAGSREECLAHVDEVWTDMRPRSVREA LS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggccgaaccccgattcctggtcgtccgcaacgacgaggagcagtactcgatctggtcg gccgaccgggacctgcccgccggctggcacgacaccggcttcgccggcagccgtgaggag tgcctggcccacgtcgacgaggtctggaccgacatgcgtccccgctcggtgcgcgaggcc ctctcatga

DBGET integrated database retrieval system