Mycolicibacterium aubagnense: MAUB_49750 Help Entry MAUB_49750        CDS       T07121                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism maub  Mycolicibacterium aubagnense Pathway maub00261   Monobactam biosynthesis maub01100   Metabolic pathways maub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:maub00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MAUB_49750  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:maub01008]     MAUB_49750 Polyketide biosynthesis proteins [BR:maub01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MAUB_49750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBX87102 LinkDB All DBs Position 5149226..5149438 Genome browser AA seq 70 aa AA seqDB search MSSNPFDDENGAFYVLINDEEQHSLWPVFADVPAGWRVVFGESARADCLAYVEETWTDIR PKTLRDTLAG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaatccgttcgatgacgagaacggtgcgttctatgtcctgatcaacgacgaa gagcagcacagcctgtggccggtgttcgccgacgtgcccgccggttggcgggtcgtgttc ggcgagagcgcgcgcgcggactgcctggcctacgtcgaggaaacctggaccgacatccgg cccaagacgctccgggacaccctggccggctga

DBGET integrated database retrieval system